| Basic Information | |
|---|---|
| Taxon OID | 3300029889 Open in IMG/M |
| Scaffold ID | Ga0246001_1006484 Open in IMG/M |
| Source Dataset Name | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Georgia Institute of Technology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4602 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat → Peat Microbial Communities From Marcell Experimental Forest Bog In Minnesota, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Minnesota | |||||||
| Coordinates | Lat. (o) | 47.506 | Long. (o) | -93.454 | Alt. (m) | Depth (m) | .3 to .4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036967 | Metagenome / Metatranscriptome | 169 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0246001_10064841 | F036967 | AGGAGG | LKHAIKFVSVGVLLLALQSLALCQEARVYREGSNWVQEMTGDLGAARNLRV |
| ⦗Top⦘ |