Scaffold Ga0134606_10131585

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134606_10131585

Scaffold Ga0134606_10131585

Overview

Basic Information
Taxon OID	3300029827 Open in IMG/M
Scaffold ID	Ga0134606_10131585 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Battelle Memorial Institute
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	780
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From New Orleans, Usa To Study Impact Of Deep Water Horizon Explosion

Source Dataset Sampling Location
Location Name	USA: Barataria Bay
Coordinates	Lat. (^o)	29.468	Long. (^o)	-89.882	Alt. (m)		Depth (m)	.08 to .12
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025653	Metagenome / Metatranscriptome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134606_101315852	F025653	N/A	MSDPVKYFEAKLKEMSLGELQAYKKRLEQSIQQKILDNKANEEIASLILYRGILEHEMKKRAL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.