| Basic Information | |
|---|---|
| Taxon OID | 3300029827 Open in IMG/M |
| Scaffold ID | Ga0134606_10000649 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Battelle Memorial Institute |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 14715 |
| Total Scaffold Genes | 14 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (78.57%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From New Orleans, Usa To Study Impact Of Deep Water Horizon Explosion |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Barataria Bay | |||||||
| Coordinates | Lat. (o) | 29.468 | Long. (o) | -89.882 | Alt. (m) | Depth (m) | .08 to .12 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F078289 | Metagenome / Metatranscriptome | 116 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134606_100006494 | F078289 | GAGG | MKKVVILILLIMVAPLYGFNSLVRHEDISKMKELGISQEVIQYFITNQTSSISSEDVIKMKQSGLSNKDILSAIQSDLYRPEKKSTPMKEAELVAKLKAAGMSDEAVLQFLQEVRSNYQVDSNGFVSKHYTNESQRTPYPTTGATFPKPENYGYDPLNGRYYYFVTPRNKP |
| ⦗Top⦘ |