Scaffold Ga0134606_10000141

Overview

Basic Information

• Taxon OID: 3300029827
• Scaffold ID: Ga0134606_10000141
• Source Dataset Name: Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Battelle Memorial Institute
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 26135
• Total Scaffold Genes: 33
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 15 (45.45%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From New Orleans, Usa To Study Impact Of Deep Water Horizon Explosion

Source Dataset Sampling Location

• Location Name: USA: Barataria Bay
• Coordinates
  • Lat. (^o): 29.468
  • Long. (^o): -89.882
  • Depth (m): .08 to .12

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089823	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134606_1000014133	F089823	AGGA	MGQKLVMRTYEQICLDKLRELGMASASEWAFAMGYKNPNALSKVIKRIIKTMPEDLIVYDNKKPRLY