Scaffold Ga0134835_1073139

Overview

Basic Information

• Taxon OID: 3300029825
• Scaffold ID: Ga0134835_1073139
• Source Dataset Name: Liquor fermentation pit mud microbial communities from Luzhou, China - Meta-1-2-440-M
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chongqing University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 806
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China

Source Dataset Sampling Location

• Location Name: China: Luzhou
• Coordinates
  • Lat. (^o): 28.88
  • Long. (^o): 105.45
  • Depth (m): .01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073228	Metagenome / Metatranscriptome	120	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134835_10731392	F073228	GGCGG	MAIITIGDIMDVNNSKYGEFLYKIVMVFPHNLEVDKTELARLIKINNNILTFERKNGEKFTLDERDVEHIDLFRSPNYRGGE