| Basic Information | |
|---|---|
| Taxon OID | 3300029825 Open in IMG/M |
| Scaffold ID | Ga0134835_1028644 Open in IMG/M |
| Source Dataset Name | Liquor fermentation pit mud microbial communities from Luzhou, China - Meta-1-2-440-M |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chongqing University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1942 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Luzhou | |||||||
| Coordinates | Lat. (o) | 28.88 | Long. (o) | 105.45 | Alt. (m) | Depth (m) | .01 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034940 | Metagenome / Metatranscriptome | 173 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134835_10286441 | F034940 | AGGAG | MGNDCWYYRAQYAGMTKVCMRQSIVECGRIRRFGLCPIPPDSEAWRRCGFAIGHHEIPARYEG |
| ⦗Top⦘ |