Basic Information | |
---|---|
Taxon OID | 3300029822 Open in IMG/M |
Scaffold ID | Ga0134854_1073208 Open in IMG/M |
Source Dataset Name | Liquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-3-30-T |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Chongqing University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 652 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Chengdu | |||||||
Coordinates | Lat. (o) | 30.65 | Long. (o) | 104.06 | Alt. (m) | Depth (m) | .01 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042860 | Metagenome / Metatranscriptome | 157 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134854_10732082 | F042860 | GGAGG | MMTREEVMKRIEIEDARIASADRNIEGLILQKNKSLDEQSRLFALLEALPSEEQEAGG |
⦗Top⦘ |