NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247275_1178702

Scaffold Ga0247275_1178702


Overview

Basic Information
Taxon OID3300029817 Open in IMG/M
Scaffold IDGa0247275_1178702 Open in IMG/M
Source Dataset NameSoil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)522
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Marcell Experimental Forest, Minnesota, Usa

Source Dataset Sampling Location
Location NameUSA: Minnesota, Marcell Experimental Forest
CoordinatesLat. (o)47.5062Long. (o)-93.45426667Alt. (m)Depth (m)25 to 50
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089300Metagenome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0247275_11787021F089300N/AALGVRTTRESHYKGPVEVWVDGAQRFEADVHLTKRESVEEFETLGGSESVPLATTWDGRFHGLAQEELRTLQAVGEFELSLPGDRKGRAVVPNGRDLAYLQGLGDPPF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.