Scaffold Ga0247275_1036411

Overview

Basic Information

• Taxon OID: 3300029817
• Scaffold ID: Ga0247275_1036411
• Source Dataset Name: Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1449
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Marcell Experimental Forest, Minnesota, Usa

Source Dataset Sampling Location

• Location Name: USA: Minnesota, Marcell Experimental Forest
• Coordinates
  • Lat. (^o): 47.5062
  • Long. (^o): -93.45426667
  • Depth (m): 25 to 50

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084800	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247275_10364113	F084800	N/A	EGASQIAVDLEAIEALGVCPVLGDYLEEGVVARHATDQVAHDLMALMAQAPDRQTIRG