| Basic Information | |
|---|---|
| Taxon OID | 3300029817 Open in IMG/M |
| Scaffold ID | Ga0247275_1029296 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Georgia Institute of Technology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1661 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Marcell Experimental Forest, Minnesota, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Minnesota, Marcell Experimental Forest | |||||||
| Coordinates | Lat. (o) | 47.5062 | Long. (o) | -93.45426667 | Alt. (m) | Depth (m) | 25 to 50 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026895 | Metagenome / Metatranscriptome | 196 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247275_10292961 | F026895 | AGGAGG | MSFPRHGEIYPCDEGAISRPRPRSSPWMSLQLAIPGRLLSSRARFRFASRSYTANHQSRCTMLLQRTAKCRLTDCLSRGVQSIAYVPPLNMSPTTIKFP |
| ⦗Top⦘ |