Scaffold Ga0244882_1022724

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0244882_1022724

Scaffold Ga0244882_1022724

Overview

Basic Information
Taxon OID	3300029815 Open in IMG/M
Scaffold ID	Ga0244882_1022724 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from Shanghai, China - P010V6
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1909
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China

Source Dataset Sampling Location
Location Name	China: Shanghai
Coordinates	Lat. (^o)	31.2112312	Long. (^o)	121.4647709	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055775	Metagenome	138	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0244882_10227242	F055775	N/A	MAQIAQQDNLVIEVTTTAAALDGDTKAKLIACIEGGTIADVVLVTKEVEKKISHAKIVSWLVDTTGDSPKYTIYIVNANSESIETIALN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.