NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0311022_13205072

Scaffold Ga0311022_13205072


Overview

Basic Information
Taxon OID3300029799 Open in IMG/M
Scaffold IDGa0311022_13205072 Open in IMG/M
Source Dataset NameMetagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Toronto
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)579
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location NameToronto, Ontario, canada
CoordinatesLat. (o)43.5479Long. (o)-79.6609Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027342Metagenome195Y

Sequences

Protein IDFamilyRBSSequence
Ga0311022_132050721F027342N/AAKKIAAGKAFSMQSQYVKKKYFLLTRIRSSPGAFADLPRSISDAAEFFRAEEGSSTEKLFWSQYLAPKHPMPLSDQLKQLVELHRVAELAMKGVIVRMWPGEIMPSSYFGLIKQMVDACPWLEVIKRSICIEGARQAFARVKVHWGKLDAEKLVKDRPPEGKAHRHPELYYDGIMKGARLVADECTKDTVFE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.