Scaffold Ga0311022_10649358

Overview

Basic Information

• Taxon OID: 3300029799
• Scaffold ID: Ga0311022_10649358
• Source Dataset Name: Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Toronto
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 546
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location

• Location Name: Toronto, Ontario, canada
• Coordinates
  • Lat. (^o): 43.5479
  • Long. (^o): -79.6609

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020862	Metagenome / Metatranscriptome	221	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0311022_106493581	F020862	AGGAG	MQNLRSKSIKVQIXKKSLTSLQNRCLEFSNRCVQRLKQVFYFVGASSEKFTPSVEDLPGAFEHIEGEIDDLDKVIAGHGDFCALVASRGTTVAFLQSGCEHGKIINRPNFCLSPADLDNIPNLARSIANRFIKLVWTKGGRSKAGDEARSHL