| Basic Information | |
|---|---|
| Taxon OID | 3300029799 Open in IMG/M |
| Scaffold ID | Ga0311022_10453053 Open in IMG/M |
| Source Dataset Name | Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Toronto |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1031 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate → Metagenomes From Anaerobic Digester Of Solid Waste |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Toronto, Ontario, canada | |||||||
| Coordinates | Lat. (o) | 43.5479 | Long. (o) | -79.6609 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053724 | Metagenome | 140 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0311022_104530532 | F053724 | GAGG | MREVRVLVRLQVDECEPDAEFDRETMEDSAVEAVENAMRFAYDNGFSHTYADELSIGFVDAVLYEEDLDDEDGLDEE |
| ⦗Top⦘ |