| Basic Information | |
|---|---|
| Taxon OID | 3300029798 Open in IMG/M |
| Scaffold ID | Ga0239581_1123471 Open in IMG/M |
| Source Dataset Name | Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM11 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Uppsala University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 519 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Alinen Mustajarvi, Finland |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Finland: Alinen Mustajarvi in Hameenlinna | |||||||
| Coordinates | Lat. (o) | 61.208142 | Long. (o) | 25.113609 | Alt. (m) | Depth (m) | 5.1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F074307 | Metagenome | 119 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0239581_11234712 | F074307 | AGG | MIEILTERKNMKIDFGETRLEKVDRLSKPHKWFAWYPVEISAHDYRWLEYVERAGRPSALCEGLWFWKYKAIPKTVGDVLKGVEND |
| ⦗Top⦘ |