NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0239581_1050071

Scaffold Ga0239581_1050071


Overview

Basic Information
Taxon OID3300029798 Open in IMG/M
Scaffold IDGa0239581_1050071 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Alinen Mustajarvi, Finland - AM11
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUppsala University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)943
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Alinen Mustajarvi, Finland

Source Dataset Sampling Location
Location NameFinland: Alinen Mustajarvi in Hameenlinna
CoordinatesLat. (o)61.208142Long. (o)25.113609Alt. (m)Depth (m)5.1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F100246Metagenome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0239581_10500711F100246N/AESGSNCSVVLSNNGVSGVGQGVNTPGTDDIYTDYFSILCLIRDTLNNPIGEDLKPSDFIGCARFDISDYLRSKFSAWEITRFEFPEIVGNVRVHGWDYLLKYRVSFAESIAGNVRGLQSDGWKYALAGGLNHELLTSLNEKYLEYFSIPANKSKFLSWLPTTKYSRSGVMEKLFFLFQDNPTGIQYRLVVVITFTDGSHKIVNATPQVTYPAFSVMEFKVGFDHLDLVNAQYGKTVQSWEVYLMDSNDDLLSEVRVFYNDTRVFENEKVFFYRNSFSAYDTFRFLGKSELNLEYERQIGTTVREEKYSFFNAST

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.