Scaffold Ga0239581_1044581

Overview

Basic Information

• Taxon OID: 3300029798
• Scaffold ID: Ga0239581_1044581
• Source Dataset Name: Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM11
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Uppsala University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1024
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Alinen Mustajarvi, Finland

Source Dataset Sampling Location

• Location Name: Finland: Alinen Mustajarvi in Hameenlinna
• Coordinates
  • Lat. (^o): 61.208142
  • Long. (^o): 25.113609
  • Depth (m): 5.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061478	Metagenome	131	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0239581_10445812	F061478	N/A	MQAATIEIHYDGTPMEVFQQIRVGRLRLYNAAARDRLGVVQETWKRGALGKTFLVRPIAGQIVGEEVVDNAGRVIAVFGLAITNAFLPDPRPQREYREKLQTLLKEL