Basic Information | |
---|---|
Taxon OID | 3300029798 Open in IMG/M |
Scaffold ID | Ga0239581_1023756 Open in IMG/M |
Source Dataset Name | Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM11 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Uppsala University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1597 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Alinen Mustajarvi, Finland |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Finland: Alinen Mustajarvi in Hameenlinna | |||||||
Coordinates | Lat. (o) | 61.208142 | Long. (o) | 25.113609 | Alt. (m) | Depth (m) | 5.1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056624 | Metagenome | 137 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0239581_10237562 | F056624 | N/A | MTAPSDQLHDLSEKCDLCRESVRERLAAFDRRLLALEIVVRGEDGRNGMKSQLTTLCARFDAFEKKAIRVIAICTSLPGVIVAVVAVLKFFGRV |
⦗Top⦘ |