Scaffold Ga0183826_1077004

Overview

Basic Information

• Taxon OID: 3300029792
• Scaffold ID: Ga0183826_1077004
• Source Dataset Name: Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 500
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Nilusvirus → Nilusvirus ssm2 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_041
• Coordinates
  • Lat. (^o): 14.6059
  • Long. (^o): 69.9776
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025518	Metagenome / Metatranscriptome	201	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0183826_10770041	F025518	N/A	MAMEESKVTKMSEEKLTHYTKTSLREEAKLYLPTVREFYPHLDGMLTERIAKYCAIYSKGTDKASIRQAINDFEEVFDQELTQ