NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0183826_1046593

Scaffold Ga0183826_1046593


Overview

Basic Information
Taxon OID3300029792 Open in IMG/M
Scaffold IDGa0183826_1046593 Open in IMG/M
Source Dataset NameMarine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)670
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameIndian Ocean: TARA_041
CoordinatesLat. (o)14.6059Long. (o)69.9776Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000639Metagenome968Y

Sequences

Protein IDFamilyRBSSequence
Ga0183826_10465932F000639N/AMIHTSYTVGITTAEFKALESVMTDQQFWIENAIQNRARIAIENIQTNYTNFKISKGEAITAVGTTAIIEAAYAEGVVGIVT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.