Scaffold Ga0183757_1006225

Overview

Basic Information

• Taxon OID: 3300029787
• Scaffold ID: Ga0183757_1006225
• Source Dataset Name: Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3857
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Mediterranean Sea: TARA_018
• Coordinates
  • Lat. (^o): 35.7528
  • Long. (^o): 14.2765
  • Depth (m): 60

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059879	Metagenome	133	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0183757_10062254	F059879	N/A	MKTLVFILVILEGSEIYDDTMQYGSIDRCSWYADKINYYNQKQTRNTYSAHCKPLVIEKNED