Scaffold Ga0183757_1001447

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0183757_1001447

Scaffold Ga0183757_1001447

Overview

Basic Information
Taxon OID	3300029787 Open in IMG/M
Scaffold ID	Ga0183757_1001447 Open in IMG/M
Source Dataset Name	Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10153
Total Scaffold Genes	17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (64.71%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	Mediterranean Sea: TARA_018
Coordinates	Lat. (^o)	35.7528	Long. (^o)	14.2765	Alt. (m)		Depth (m)	60
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027817	Metagenome	193	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0183757_10014474	F027817	N/A	MIKKLKNFICKIFGIKQCACSEQDEHLVLYEEVTNRKQDKINKKHGKGSE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.