| Basic Information | |
|---|---|
| Taxon OID | 3300029781 Open in IMG/M |
| Scaffold ID | Ga0167330_1032056 Open in IMG/M |
| Source Dataset Name | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP11 - Uppsala-digested 112 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Gothenburg |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 946 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_187 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden | |||||||
| Coordinates | Lat. (o) | 59.844519 | Long. (o) | 17.659844 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059711 | Metagenome | 133 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0167330_10320562 | F059711 | AGGAGG | MRKRILHTSINLLIEPDTYQRLKMIAGLQKTTMSKFIREGIKLRLAQYDKENNSIVTESQ |
| ⦗Top⦘ |