Scaffold Ga0167330_1004502

Overview

Basic Information

• Taxon OID: 3300029781
• Scaffold ID: Ga0167330_1004502
• Source Dataset Name: Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP11 - Uppsala-digested 112
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Gothenburg
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3873
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location

• Location Name: Sweden
• Coordinates
  • Lat. (^o): 59.844519
  • Long. (^o): 17.659844

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022683	Metagenome / Metatranscriptome	213	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0167330_10045024	F022683	GGAGG	MASEMADQMKPLTEFYAKWSKDALEMMSKGLGMYDKMIRAWTEVGGQAQAEQPEDTIKKWADAFGGSYKDLFEMYTQPFKMFGAAGEIPGKEAWQDAFSKWQKMFTAMPSGSTPXXXSMQTMGEACKAAVSEGENPDAAMGAFTEISDKFMQQWAAFVTDQAQAFFSLWRSRLPDEKTEPKRPKKA