Scaffold Ga0206087_1048987

Overview

Basic Information

• Taxon OID: 3300029695
• Scaffold ID: Ga0206087_1048987
• Source Dataset Name: Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 522
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.305
  • Long. (^o): -116.2547

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093804	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0206087_10489871	F093804	AGGTGG	MANSESKPVDDLHNRSLKKIGEIDPKLFESNNEEKEIEIKSWKKQKSEKWYVYLDTNTGHLRK