| Basic Information | |
|---|---|
| Taxon OID | 3300029680 Open in IMG/M |
| Scaffold ID | Ga0265599_1000595 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_50m (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4450 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Sakinaw lake, British Columbia | |||||||
| Coordinates | Lat. (o) | 49.68 | Long. (o) | -124.009 | Alt. (m) | Depth (m) | 50 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F031354 | Metagenome / Metatranscriptome | 182 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0265599_10005957 | F031354 | AGGA | MKTTIDINDILYPIINVPTVKATIDGGVYRNKKPLNSELQDIVIIPLSNFVGEEVMNDAVFMVNCFCKNFANGTPDITNLRPIVNAVVAVIEAYNNTSHYYIFAITNQILLQDIDQKSMSYSSLRIQCFIEK |
| ⦗Top⦘ |