NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206094_122169

Scaffold Ga0206094_122169


Overview

Basic Information
Taxon OID3300029659 Open in IMG/M
Scaffold IDGa0206094_122169 Open in IMG/M
Source Dataset NameMetatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13C (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)533
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.305Long. (o)-116.2547Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000206Metagenome / Metatranscriptome1598Y

Sequences

Protein IDFamilyRBSSequence
Ga0206094_1221691F000206N/AGLLLAILVALVAAQNKPLWPTAASASIFAHGWERRGDRHFVRFWYDQAQGKERVDGPREFEGEFYWTTTIHNTMTKREYFVIHQDSLILCYERPSNGTIPAPKFANARYIGKAEIELTPVDHWIERDETGRDHLQIFDRTDNQRIVRMDWDARHRGRDRATTFEFHEWSVGAQDPNL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.