Scaffold Ga0206093_101670

Overview

Basic Information

• Taxon OID: 3300029640
• Scaffold ID: Ga0206093_101670
• Source Dataset Name: Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20-13C (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1068
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales → Fiersviridae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.3049
  • Long. (^o): -116.2547

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028190	Metagenome / Metatranscriptome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0206093_1016702	F028190	AGGA	MPTMANITVKKFDGTTDIVYDALSASGGDGSPAVWRQDTGAASGLPVGLRKLFKLWTSWNGPRTARQMKYNFVSPYAVQDSTTTLYSAKDRVVFDGVVTIPQGLPANEINEAIYQGLNLLASTLVKQSGSSGYAPN