NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222749_10107485

Scaffold Ga0222749_10107485


Overview

Basic Information
Taxon OID3300029636 Open in IMG/M
Scaffold IDGa0222749_10107485 Open in IMG/M
Source Dataset NameMetatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1317
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000437Metagenome / Metatranscriptome1146Y
F009766Metagenome / Metatranscriptome313Y

Sequences

Protein IDFamilyRBSSequence
Ga0222749_101074851F000437GGAVEFAIVKFNDEAPKSWNIYHTEKKGLLLVQLWKRYLLVDMKEQEVFEIDPQTVKPHGKDVEWSLADKPEQPMETPDWKTKDLRSMELVKFRLGKDGHFLEMQLPLLVNGKPVY
Ga0222749_101074852F009766GGCGGMFRRRLLKRTAVFLLGSLLFPYVSQIYPPLDLDLMLVFFGVLFFIALAIAVILERGARNRKEIELLKRIYSGFIPLPWILAATLLVNGKLDSRKNVAYHPTTVDSRYNMPGIVRGTRRLFVHSWREGQKIERLAVDFDDYDRFRAGDSVVVGVEPGALGIPWYYGVYRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.