Basic Information | |
---|---|
Taxon OID | 3300029635 Open in IMG/M |
Scaffold ID | Ga0135217_115157 Open in IMG/M |
Source Dataset Name | Marine harbor viral communities from the Indian Ocean - SMH2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Michigan State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 525 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor → Marine Harbor Viral Communities From The Pacific And Indian Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Indian Ocean | |||||||
Coordinates | Lat. (o) | 1.26600833 | Long. (o) | 103.8333333 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026271 | Metagenome / Metatranscriptome | 198 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0135217_1151572 | F026271 | GGA | MISRSPRGTWCDYCKQHYGTNTPRGQTQAVWQITSKRYGKVIVRHYCQDCADYVQDWNGETWTLKEQIEYAKGIQKLDV |
⦗Top⦘ |