Scaffold Ga0135217_105846

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0135217_105846

Scaffold Ga0135217_105846

Overview

Basic Information
Taxon OID	3300029635 Open in IMG/M
Scaffold ID	Ga0135217_105846 Open in IMG/M
Source Dataset Name	Marine harbor viral communities from the Indian Ocean - SMH2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Michigan State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	702
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor → Marine Harbor Viral Communities From The Pacific And Indian Ocean

Source Dataset Sampling Location
Location Name	Indian Ocean
Coordinates	Lat. (^o)	1.26600833	Long. (^o)	103.8333333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063490	Metagenome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0135217_1058461	F063490	AGG	MSDCYFMLQFFGTYGGLICGFGGFLTALAALLYAHVRVAEFEKSVSDLDWQHVIVTGKHKITIAHF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.