| Basic Information | |
|---|---|
| Taxon OID | 3300029632 Open in IMG/M |
| Scaffold ID | Ga0135266_100815 Open in IMG/M |
| Source Dataset Name | Marine harbor viral communities from the Pacific Ocean - SMB3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Michigan State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1298 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor → Marine Harbor Viral Communities From The Pacific And Indian Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 34.536667 | Long. (o) | 122.141667 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019926 | Metagenome | 227 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0135266_1008152 | F019926 | AGGAGG | MITILVEDKDIVVEQYFVTLIFDREEIESMIMEHYRDEYSDHVYRVVDEEGASFTTDFLLYNDIERHDVINDLMYYHNLKPTKIKLVENENK |
| ⦗Top⦘ |