Scaffold Ga0311297_1191313

Overview

Basic Information

• Taxon OID: 3300029625
• Scaffold ID: Ga0311297_1191313
• Source Dataset Name: Mildly acidic thermal spring sediment microbial community from Yellowstone National Park, USA - SJ3 Spring
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 515
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Anacardiaceae → Pistacia → Pistacia vera (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Thermal Spring Sediment Microbial Community From Yellowstone National Park, Usa

Source Dataset Sampling Location

• Location Name: Smokejumper Geyser Basin, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.41595
  • Long. (^o): -110.95576667

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023843	Metagenome / Metatranscriptome	208	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0311297_11913132	F023843	N/A	MASGGKIEIKKFNGQSFELWKLKMEDLLVDKDQWIMIYLGTKPKRMLT