NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0311297_1169265

Scaffold Ga0311297_1169265


Overview

Basic Information
Taxon OID3300029625 Open in IMG/M
Scaffold IDGa0311297_1169265 Open in IMG/M
Source Dataset NameMildly acidic thermal spring sediment microbial community from Yellowstone National Park, USA - SJ3 Spring
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Wisconsin, Madison
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)60818
Total Scaffold Genes72 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)46 (63.89%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Thermal Spring Sediment Microbial Community From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameSmokejumper Geyser Basin, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.41595Long. (o)-110.95576667Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071410Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0311297_116926571F071410N/AMEVNGDLSTYRFNKDNVIRLIAIGISNQVSKAKGSAVSITTSNILGELNGGEPIIGHTARRGIVKYFLDALVSKGYMIVYRKGSKKPRNTARVHVYIIPKKLKHNIPNPLFSADPNLIYVFLESVLSDVD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.