Basic Information | |
---|---|
Taxon OID | 3300029625 Open in IMG/M |
Scaffold ID | Ga0311297_1108349 Open in IMG/M |
Source Dataset Name | Mildly acidic thermal spring sediment microbial community from Yellowstone National Park, USA - SJ3 Spring |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Wisconsin, Madison |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2313 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Thermal Spring Sediment Microbial Community From Yellowstone National Park, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Smokejumper Geyser Basin, Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.41595 | Long. (o) | -110.95576667 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041867 | Metagenome / Metatranscriptome | 159 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0311297_11083494 | F041867 | N/A | MNTFDREFWNVVLKASIMIEKDLKKLLNEEGPGEKKGISITIARVREIKKSIETLQGNSVMKKPKKIEAG |
⦗Top⦘ |