Scaffold Ga0311297_1031003

Overview

Basic Information

• Taxon OID: 3300029625
• Scaffold ID: Ga0311297_1031003
• Source Dataset Name: Mildly acidic thermal spring sediment microbial community from Yellowstone National Park, USA - SJ3 Spring
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1342
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Methanomassiliicoccales → unclassified Methanomassiliicoccales → Methanomassiliicoccales archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Thermal Spring Sediment Microbial Community From Yellowstone National Park, Usa

Source Dataset Sampling Location

• Location Name: Smokejumper Geyser Basin, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.41595
  • Long. (^o): -110.95576667

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019254	Metagenome	231	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0311297_10310032	F019254	AGG	MPSEKIQEALSYLQDDWPIRVLLSAPAERVAELAALLGRAEAQKLPPEFRTRIQAIEEEMHVLSRLCQNPPRPEMGNRRKVDSLPLF