| Basic Information | |
|---|---|
| Taxon OID | 3300029617 Open in IMG/M |
| Scaffold ID | Ga0245125_107295 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35739 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4144 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | United Kingdom: London | |||||||
| Coordinates | Lat. (o) | 51.5 | Long. (o) | -0.12 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076189 | Metagenome | 118 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0245125_1072957 | F076189 | N/A | LKKRINHFKTMQCPAGCVICRALFFYFLSPFIKPLLYVEKLQIGTVLPVVPDLYREFSEILACFDLCAIQSAQKQLHMLCNFHENTLGLLIFYTDYAII |
| ⦗Top⦘ |