| Basic Information | |
|---|---|
| Taxon OID | 3300029569 Open in IMG/M |
| Scaffold ID | Ga0311280_115246 Open in IMG/M |
| Source Dataset Name | Moderately acidic thermal spring sediment microbial community from Yellowstone National Park, USA - MV2 Spring |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Wisconsin, Madison |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 514 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Thermal Spring Sediment Microbial Community From Yellowstone National Park, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Yellowstone National Park, Wyoming | |||||||
| Coordinates | Lat. (o) | 44.61003889 | Long. (o) | -110.43943056 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049309 | Metagenome / Metatranscriptome | 147 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0311280_1152462 | F049309 | N/A | ILQLMSWKLPVVCGVYRLKRVDMQVFPFSIYKWDYQKNNYRYLVPEDIPKNWRLIPIEGGGLGICLIDMNVFNDIEEPYFKWELYPWNPPPGGLSEDLYFFKKLIDKGIQPYADLNITASHYLAPPVALRFDGTLYNTP |
| ⦗Top⦘ |