Scaffold Ga0311280_106308

Overview

Basic Information

• Taxon OID: 3300029569
• Scaffold ID: Ga0311280_106308
• Source Dataset Name: Moderately acidic thermal spring sediment microbial community from Yellowstone National Park, USA - MV2 Spring
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 927
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Hyperthermophilic Archaeal Virus 1 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Thermal Spring Sediment Microbial Community From Yellowstone National Park, Usa

Source Dataset Sampling Location

• Location Name: USA: Yellowstone National Park, Wyoming
• Coordinates
  • Lat. (^o): 44.61003889
  • Long. (^o): -110.43943056

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017763	Metagenome	239	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0311280_1063081	F017763	N/A	GVLMYLAYQFTEFIVKHDTIYKDIATFMAGYFGTLAVSGIPL