Scaffold Ga0244855_104115

Overview

Basic Information

• Taxon OID: 3300029535
• Scaffold ID: Ga0244855_104115
• Source Dataset Name: Human fecal microbial communities from Shanghai Jiao Tong University, China - SZAXPI022000-43
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3176
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China

Source Dataset Sampling Location

• Location Name: China: Shanghai
• Coordinates
  • Lat. (^o): 31.2123446
  • Long. (^o): 121.4684853

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068941	Metagenome	124	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0244855_1041154	F068941	N/A	MIGGTYAYYRWNSTSNINVSVKISGNTVTFVGGSNVTGTLTPVDSKEEGIKKDITVKASEAGSTMSLYMDLTTMPNELKEESFVYELYYNDTTLVTKGNFKAYNASSNASGITYASSGVTTLILFTDRNVNTTTDKYTLYLWFNGKDFTNPDTMQNKTLSFNLYATGKNATLNG