Scaffold Ga0167332_1040352

Overview

Basic Information

• Taxon OID: 3300029446
• Scaffold ID: Ga0167332_1040352
• Source Dataset Name: Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP13 - Kappala-digested 114
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Gothenburg
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1029
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location

• Location Name: Sweden
• Coordinates
  • Lat. (^o): 59.355554
  • Long. (^o): 18.227079

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073596	Metagenome / Metatranscriptome	120	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0167332_10403521	F073596	N/A	MNVFEKIKLWFTSISKVVNFLINTYKDAEVLADKKANFKTWADFVIAFIKDALQYADEIAALAQSQPVQTKGQVIKAVKQDKKISTNYQTA