| Basic Information | |
|---|---|
| Taxon OID | 3300029442 Open in IMG/M |
| Scaffold ID | Ga0239579_1059288 Open in IMG/M |
| Source Dataset Name | Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM13 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Uppsala University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 573 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Alinen Mustajarvi, Finland |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Finland: Alinen Mustajarvi in Hameenlinna | |||||||
| Coordinates | Lat. (o) | 61.208142 | Long. (o) | 25.113609 | Alt. (m) | Depth (m) | 6.1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073009 | Metagenome | 120 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0239579_10592881 | F073009 | N/A | PMLSILIADQSLDLSDDFSVSLNLKSPIFNDVGDYSFPFKVPSTPRNVSILGWKNRLASKRSIYETYEGSIRWNGMVLYTGQIKIKTANDKSFEGTLYINKGNFNYEIKDLLLNRMDLGMKSFPSDQDAVNYFNWSLTHFYPEVDFSVPEIGNLDFFDPQATNPELMAYNHIFPDGWLHKTTSDGQSRTI |
| ⦗Top⦘ |