NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167329_1018344

Scaffold Ga0167329_1018344


Overview

Basic Information
Taxon OID3300029440 Open in IMG/M
Scaffold IDGa0167329_1018344 Open in IMG/M
Source Dataset NameBiosolids microbial communities from sewage treatment plant in Sweden - SWESTP10 - Uppsala-digested 111
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Gothenburg
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1731
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location
Location NameSweden
CoordinatesLat. (o)59.844519Long. (o)17.659844Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023356Metagenome / Metatranscriptome210Y
F045118Metagenome / Metatranscriptome153N

Sequences

Protein IDFamilyRBSSequence
Ga0167329_10183441F023356AGGAGMSENSLKKAVLESRASAAEAEAMSTELKKSKVITLRVEEPLFKAIEAQAELWKVKPAETIRRVLWFYFLPAALEMQLRGESEKFWKGELTPEAAGEYMVFTLEAVEKLRSSAMFLSREA
Ga0167329_10183444F045118N/AEFCVYDKLQEMREHGLETSELPETMRFEHRALKKEKVRSLYGFTRVNELFHGGYEVVKEKQVENWKNSLFSFSAEEVVVLGSKQLEQEMKAFQEKFGSNWFQYFLKSYGAYSLAKFAGKEVVRAALENLNSERTKVWRTMKLLEEAXXXXLRESF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.