| Basic Information | |
|---|---|
| Taxon OID | 3300029440 Open in IMG/M |
| Scaffold ID | Ga0167329_1013710 Open in IMG/M |
| Source Dataset Name | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP10 - Uppsala-digested 111 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Gothenburg |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2175 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes → unclassified Candidatus Cloacimonetes → Candidatus Cloacimonetes bacterium ADurb.Bin088 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden | |||||||
| Coordinates | Lat. (o) | 59.844519 | Long. (o) | 17.659844 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058560 | Metagenome / Metatranscriptome | 135 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0167329_10137103 | F058560 | GAGG | MGKSDVRCPKCGKATNEVELIYPRTDDYEEKRVRAIICPHCLYVFGESDVENNNYSFRNESLV |
| ⦗Top⦘ |