NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0243191_144496

Scaffold Ga0243191_144496


Overview

Basic Information
Taxon OID3300029403 Open in IMG/M
Scaffold IDGa0243191_144496 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from healthy subjects in Hangzhou, China - HD-30_Run1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterZhejiang University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)514
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China

Source Dataset Sampling Location
Location NameChina: Hangzhou
CoordinatesLat. (o)30.0Long. (o)120.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027342Metagenome195Y

Sequences

Protein IDFamilyRBSSequence
Ga0243191_1444961F027342N/ADSYKALQEIEAVKKIAAGKAFFMQSKHVSVNYLLLTRIRSSPGAFADLPRSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQLKQLVELHKAAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACPWVEVIKRSACIEGARRALARAKVHWGKLDAEKLITDAPPV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.