| Basic Information | |
|---|---|
| Taxon OID | 3300029349 Open in IMG/M |
| Scaffold ID | Ga0238435_117647 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 587 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Klamath Basin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Iron Gate Dam, Klamath Basin, California | |||||||
| Coordinates | Lat. (o) | 41.93 | Long. (o) | -122.44 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010535 | Metagenome / Metatranscriptome | 302 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0238435_1176472 | F010535 | AGGA | MTEPQIVDYSVYTGVMDNGQEILVQIFTSPESGKFLLGQIAFRSATSTWGMPIPLEKR |
| ⦗Top⦘ |