Scaffold Ga0238435_100111

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0238435_100111

Scaffold Ga0238435_100111

Overview

Basic Information
Taxon OID	3300029349 Open in IMG/M
Scaffold ID	Ga0238435_100111 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	21098
Total Scaffold Genes	29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	28 (96.55%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Klamath Basin, Usa

Source Dataset Sampling Location
Location Name	USA: Iron Gate Dam, Klamath Basin, California
Coordinates	Lat. (^o)	41.93	Long. (^o)	-122.44	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015703	Metagenome / Metatranscriptome	252	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0238435_10011110	F015703	GAGG	LFQGFLNSLDKKDFEIKRDMYRNGRLVVEIEQKHRDQDWKPSGLSVTTAKWWVYLFSDDAFLVVEVARLKKYIEINNSMELKTFAPRSYNPTRGYLLLAEDVSKLMASELYDTKEKK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.