| Basic Information | |
|---|---|
| Taxon OID | 3300029319 Open in IMG/M |
| Scaffold ID | Ga0183748_1104789 Open in IMG/M |
| Source Dataset Name | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 641 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Red Sea: TARA_032 | |||||||
| Coordinates | Lat. (o) | 23.36 | Long. (o) | 37.2183 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041143 | Metagenome / Metatranscriptome | 160 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0183748_11047892 | F041143 | GGAG | MENPRIDGIDWRNLQKGDKISKEKVLDFWNIHFKDKPWDERTSLLQVKGCLEKLREGINRPLVIRQRDYELFVLKDFEAVDYLAAQANSGIRKHRKQTRRMFTHVDQANLDQAKKRDLETKQIHHAFIAAAADGARKESLQLQRKGERLPKSLIEKSDFKKSS |
| ⦗Top⦘ |