Scaffold Ga0183748_1045810

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0183748_1045810

Scaffold Ga0183748_1045810

Overview

Basic Information
Taxon OID	3300029319 Open in IMG/M
Scaffold ID	Ga0183748_1045810 Open in IMG/M
Source Dataset Name	Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1276
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	Red Sea: TARA_032
Coordinates	Lat. (^o)	23.36	Long. (^o)	37.2183	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001006	Metagenome / Metatranscriptome	808	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0183748_10458101	F001006	N/A	MEKADTLKEINRKSTNIMSFFDDNDKEHELQKQQSAAELKKQEYLKSVELLKKLIKKNGTKEHFTRITAVGYLIETTDFLNLKPDRKKMLKENMIW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.