NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134545_1009331

Scaffold Ga0134545_1009331


Overview

Basic Information
Taxon OID3300029310 Open in IMG/M
Scaffold IDGa0134545_1009331 Open in IMG/M
Source Dataset NameHuman fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10010
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bologna
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3346
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy

Source Dataset Sampling Location
Location NameTanzania
CoordinatesLat. (o)-3.6347588Long. (o)35.0828588Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032286Metagenome / Metatranscriptome180Y

Sequences

Protein IDFamilyRBSSequence
Ga0134545_10093311F032286AGGVTPIRHRALVFNTRLFAGTAADDALVTGSTLSFCRLMCLCVKRRNIMLNDKRRSLLNSALFRAYNRTERKTISLFSLALIFTFDFAALSERRSCPEDRSRRFVLLGALDAALRQRTYPVRTVMQFSRFRCDCKTILAKNIALSRISKRSENAPKNANFHAYGQGRKRAEF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.